Lineage for d3d0qb1 (3d0q B:2-374)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911045Family c.87.1.13: UrdGT2-like [310622] (2 proteins)
    Pfam PF06722
  6. 2911046Protein Calicheamicin glycosyltransferase CalG3 [310723] (1 species)
  7. 2911047Species Micromonospora echinospora [TaxId:1877] [310970] (3 PDB entries)
  8. 2911053Domain d3d0qb1: 3d0q B:2-374 [305184]
    Other proteins in same PDB: d3d0qa2, d3d0qb2
    automated match to d3d0ra_
    complexed with mpo

Details for d3d0qb1

PDB Entry: 3d0q (more details), 2.79 Å

PDB Description: crystal structure of calg3 from micromonospora echinospora determined in space group i222
PDB Compounds: (B:) Protein CalG3

SCOPe Domain Sequences for d3d0qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0qb1 c.87.1.13 (B:2-374) Calicheamicin glycosyltransferase CalG3 {Micromonospora echinospora [TaxId: 1877]}
lfvsspgighlfpliqlawgfrtaghdvliavaehadraaaaglevvdvapdysavkvfe
qvakdnprfaetvatrpaidleewgvqiaavnrplvdgtmalvddyrpdlvvyeqgatvg
llaadragvpavqrnqsawrtrgmhrsiasfltdlmdkhqvslpepvatiesfppsllle
aepegwfmrwvpygggavlgdrlppvparpevaitmgtielqafgigavepiiaaagevd
adfvlalgdldisplgtlprnvravgwtplhtllrtctavvhhggggtvmtaidagipql
lapdprdqfqhtareavsrrgiglvstsdkvdadllrrligdeslrtaarevreemvalp
tpaetvrriveri

SCOPe Domain Coordinates for d3d0qb1:

Click to download the PDB-style file with coordinates for d3d0qb1.
(The format of our PDB-style files is described here.)

Timeline for d3d0qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d0qb2