Lineage for d3cxta_ (3cxt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (217 species)
    not a true protein
  7. 2095996Species Streptococcus suis [TaxId:391295] [225629] (3 PDB entries)
  8. 2095997Domain d3cxta_: 3cxt A: [305177]
    automated match to d3ctmb_
    complexed with ca, gkr, nap

Details for d3cxta_

PDB Entry: 3cxt (more details), 1.9 Å

PDB Description: Quaternary complex structure of gluconate 5-dehydrogenase from Streptococcus suis type 2
PDB Compounds: (A:) Dehydrogenase with different specificities

SCOPe Domain Sequences for d3cxta_:

Sequence, based on SEQRES records: (download)

>d3cxta_ c.2.1.0 (A:) automated matches {Streptococcus suis [TaxId: 391295]}
qfsldqfslkgkialvtgasygigfaiasayakagativfndinqelvdrgmaaykaagi
nahgyvcdvtdedgiqamvaqiesevgiidilvnnagiirrvpmiemtaaqfrqvididl
napfivskavipsmikkghgkiinicsmmselgretvsayaaakgglkmltkniaseyge
aniqcngigpgyiatpqtaplrelqkdgsrhpfdqfiiaktpaarwgeaedlmgpavfla
sdasnfvnghilyvdggilayigkqp

Sequence, based on observed residues (ATOM records): (download)

>d3cxta_ c.2.1.0 (A:) automated matches {Streptococcus suis [TaxId: 391295]}
qfsldqfslkgkialvtgasygigfaiasayakagativfndinqelvdrgmaaykaagi
nahgyvcdvtdedgiqamvaqiesevgiidilvnnagiirrvpmiemtaaqfrqvididl
napfivskavipsmikkghgkiinicsmmselgretvsayaaakgglkmltkniaseyge
aniqcngigpgyiatpqthpfdqfiiaktpaarwgeaedlmgpavflasdasnfvnghil
yvdggilayigkqp

SCOPe Domain Coordinates for d3cxta_:

Click to download the PDB-style file with coordinates for d3cxta_.
(The format of our PDB-style files is described here.)

Timeline for d3cxta_:

  • d3cxta_ is new in SCOPe 2.06-stable