SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3cxta_ (3cxt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2095996Species Streptococcus suis [TaxId:391295] [225629] (3 PDB entries)
  8. 2095997Domain d3cxta_: 3cxt A: [305177]
    automated match to d3ctmb_
    complexed with ca, gkr, nap

Details for d3cxta_

PDB Entry: 3cxt (more details), 1.9 Å

PDB Description: Quaternary complex structure of gluconate 5-dehydrogenase from Streptococcus suis type 2
PDB Compounds: (A:) Dehydrogenase with different specificities

SCOPe Domain Sequences for d3cxta_:

Sequence, based on SEQRES records: (download)

>d3cxta_ c.2.1.0 (A:) automated matches {Streptococcus suis [TaxId: 391295]}
qfsldqfslkgkialvtgasygigfaiasayakagativfndinqelvdrgmaaykaagi
nahgyvcdvtdedgiqamvaqiesevgiidilvnnagiirrvpmiemtaaqfrqvididl
napfivskavipsmikkghgkiinicsmmselgretvsayaaakgglkmltkniaseyge
aniqcngigpgyiatpqtaplrelqkdgsrhpfdqfiiaktpaarwgeaedlmgpavfla
sdasnfvnghilyvdggilayigkqp

Sequence, based on observed residues (ATOM records): (download)

>d3cxta_ c.2.1.0 (A:) automated matches {Streptococcus suis [TaxId: 391295]}
qfsldqfslkgkialvtgasygigfaiasayakagativfndinqelvdrgmaaykaagi
nahgyvcdvtdedgiqamvaqiesevgiidilvnnagiirrvpmiemtaaqfrqvididl
napfivskavipsmikkghgkiinicsmmselgretvsayaaakgglkmltkniaseyge
aniqcngigpgyiatpqthpfdqfiiaktpaarwgeaedlmgpavflasdasnfvnghil
yvdggilayigkqp

SCOPe Domain Coordinates for d3cxta_:

Click to download the PDB-style file with coordinates for d3cxta_.
(The format of our PDB-style files is described here.)

Timeline for d3cxta_:

  • d3cxta_ is new in SCOPe 2.06-stable