Lineage for d3cuma4 (3cum A:163-296)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721325Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 2721336Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 2721337Species Pseudomonas aeruginosa [TaxId:208964] [311277] (1 PDB entry)
  8. 2721338Domain d3cuma4: 3cum A:163-296 [305176]
    Other proteins in same PDB: d3cuma3
    automated match to d3obba1
    complexed with act, edo, peg

Details for d3cuma4

PDB Entry: 3cum (more details), 2.2 Å

PDB Description: Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3cuma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cuma4 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 208964]}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

SCOPe Domain Coordinates for d3cuma4:

Click to download the PDB-style file with coordinates for d3cuma4.
(The format of our PDB-style files is described here.)

Timeline for d3cuma4:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cuma3