SCOPe 2.08: Domain d3cuma4: 3cum A:163-296

Lineage for d3cuma4 (3cum A:163-296)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species)
   forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively

7. Species Pseudomonas aeruginosa [TaxId:208964] [311277] (1 PDB entry)

8. Domain d3cuma4: 3cum A:163-296 [305176]
   Other proteins in same PDB: d3cuma3
   automated match to d3obba1
   complexed with act, edo, peg

Details for d3cuma4

PDB Entry: 3cum, 2.2 Å

PDB Description: Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3cuma4:

Sequence; same for both SEQRES and ATOM records:

>d3cuma4 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 208964]}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

Timeline for d3cuma4:

• d3cuma4 first appeared in SCOPe 2.06
  
• d3cuma4 appears in SCOPe 2.07