Lineage for d3ctua1 (3ctu A:1-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943524Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189092] (2 PDB entries)
  8. 2943525Domain d3ctua1: 3ctu A:1-143 [305171]
    Other proteins in same PDB: d3ctua2, d3ctub2
    automated match to d3k6eb_
    complexed with gol, po4

Details for d3ctua1

PDB Entry: 3ctu (more details), 2.81 Å

PDB Description: Crystal structure of CBS domain protein from Streptococcus pneumoniae TIGR4
PDB Compounds: (A:) CBS domain protein

SCOPe Domain Sequences for d3ctua1:

Sequence, based on SEQRES records: (download)

>d3ctua1 d.37.1.0 (A:1-143) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
miakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdekqfvgt
iglrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvvda
egifqgiitrksilkavnallhd

Sequence, based on observed residues (ATOM records): (download)

>d3ctua1 d.37.1.0 (A:1-143) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
miakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdkqfvgti
glrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvvdae
gifqgiitrksilkavnallhd

SCOPe Domain Coordinates for d3ctua1:

Click to download the PDB-style file with coordinates for d3ctua1.
(The format of our PDB-style files is described here.)

Timeline for d3ctua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ctua2