SCOPe 2.07: Domain d3ctta4: 3ctt A:732-868

Lineage for d3ctta4 (3ctt A:732-868)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families)

5. Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries)

8. Domain d3ctta4: 3ctt A:732-868 [305169]
   Other proteins in same PDB: d3ctta1, d3ctta2, d3ctta3, d3ctta5
   automated match to d2qlya4
   complexed with 3cu, gol, nag, so4

Details for d3ctta4

PDB Entry: 3ctt, 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with casuarine

PDB Compounds: (A:) Maltase-Glucoamylase

SCOPe Domain Sequences for d3ctta4:

Sequence, based on SEQRES records:

>d3ctta4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records):

>d3ctta4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpssptvtydsnlkvaii
tdidlllgeaytvew

Timeline for d3ctta4:

• d3ctta4 first appeared in SCOPe 2.06
  
• d3ctta4 appears in the current release, SCOPe 2.08