| Class b: All beta proteins [48724] (178 folds) |
| Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) ![]() |
| Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins) |
| Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries) |
| Domain d3ctta4: 3ctt A:732-868 [305169] Other proteins in same PDB: d3ctta1, d3ctta2, d3ctta3, d3ctta5 automated match to d2qlya4 complexed with 3cu, gol, nag, so4 |
PDB Entry: 3ctt (more details), 2.1 Å
SCOPe Domain Sequences for d3ctta4:
Sequence, based on SEQRES records: (download)
>d3ctta4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew
>d3ctta4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpssptvtydsnlkvaii
tdidlllgeaytvew
Timeline for d3ctta4:
View in 3DDomains from same chain: (mouse over for more information) d3ctta1, d3ctta2, d3ctta3, d3ctta5 |