Lineage for d3ctta3 (3ctt A:650-731)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420371Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)
  6. 2420380Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 [310752] (1 species)
  7. 2420381Species Human (Homo sapiens) [TaxId:9606] [311007] (3 PDB entries)
  8. 2420384Domain d3ctta3: 3ctt A:650-731 [305168]
    Other proteins in same PDB: d3ctta1, d3ctta2, d3ctta4, d3ctta5
    automated match to d2qlya3
    complexed with 3cu, gol, nag, so4

Details for d3ctta3

PDB Entry: 3ctt (more details), 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with casuarine
PDB Compounds: (A:) Maltase-Glucoamylase

SCOPe Domain Sequences for d3ctta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ctta3 b.71.1.4 (A:650-731) N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

SCOPe Domain Coordinates for d3ctta3:

Click to download the PDB-style file with coordinates for d3ctta3.
(The format of our PDB-style files is described here.)

Timeline for d3ctta3: