Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 [310752] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [311007] (3 PDB entries) |
Domain d3ctta3: 3ctt A:650-731 [305168] Other proteins in same PDB: d3ctta1, d3ctta2, d3ctta4, d3ctta5 automated match to d2qlya3 complexed with 3cu, gol, nag, so4 |
PDB Entry: 3ctt (more details), 2.1 Å
SCOPe Domain Sequences for d3ctta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ctta3 b.71.1.4 (A:650-731) N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 {Human (Homo sapiens) [TaxId: 9606]} tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv rwrkqkvemelpgdkiglhlrg
Timeline for d3ctta3:
View in 3D Domains from same chain: (mouse over for more information) d3ctta1, d3ctta2, d3ctta4, d3ctta5 |