Lineage for d3ctta2 (3ctt A:270-649)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440921Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2440933Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain [310750] (1 species)
  7. 2440934Species Human (Homo sapiens) [TaxId:9606] [311005] (3 PDB entries)
  8. 2440937Domain d3ctta2: 3ctt A:270-649 [305167]
    Other proteins in same PDB: d3ctta1, d3ctta3, d3ctta4, d3ctta5
    automated match to d2qlya2
    complexed with 3cu, gol, nag, so4

Details for d3ctta2

PDB Entry: 3ctt (more details), 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with casuarine
PDB Compounds: (A:) Maltase-Glucoamylase

SCOPe Domain Sequences for d3ctta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ctta2 c.1.8.13 (A:270-649) N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

SCOPe Domain Coordinates for d3ctta2:

Click to download the PDB-style file with coordinates for d3ctta2.
(The format of our PDB-style files is described here.)

Timeline for d3ctta2: