SCOPe 2.06: Domain d3ctta2: 3ctt A:270-649

Lineage for d3ctta2 (3ctt A:270-649)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
   Pfam PF01055

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain [310750] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311005] (3 PDB entries)

8. Domain d3ctta2: 3ctt A:270-649 [305167]
   Other proteins in same PDB: d3ctta1, d3ctta3, d3ctta4, d3ctta5
   automated match to d2qlya2
   complexed with 3cu, gol, nag, so4

Details for d3ctta2

PDB Entry: 3ctt, 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with casuarine

PDB Compounds: (A:) Maltase-Glucoamylase

SCOPe Domain Sequences for d3ctta2:

Sequence; same for both SEQRES and ATOM records:

>d3ctta2 c.1.8.13 (A:270-649) N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

Timeline for d3ctta2:

• d3ctta2 is new in SCOPe 2.06-stable
  
• d3ctta2 appears in SCOPe 2.07
  
• d3ctta2 appears in the current release, SCOPe 2.08