![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins) Pfam PF16863 |
![]() | Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain [310748] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311003] (3 PDB entries) |
![]() | Domain d3ctta1: 3ctt A:7-269 [305166] Other proteins in same PDB: d3ctta2, d3ctta3, d3ctta4, d3ctta5 automated match to d2qlya1 complexed with 3cu, gol, nag, so4 |
PDB Entry: 3ctt (more details), 2.1 Å
SCOPe Domain Sequences for d3ctta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ctta1 b.30.5.11 (A:7-269) N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq papaityrtiggildfyvflgnt
Timeline for d3ctta1:
![]() Domains from same chain: (mouse over for more information) d3ctta2, d3ctta3, d3ctta4, d3ctta5 |