Lineage for d3cefb1 (3cef B:249-384)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2061887Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2062054Protein automated matches [190608] (4 species)
    not a true protein
  7. 2062091Species European mistletoe (Viscum album) [TaxId:3972] [225471] (6 PDB entries)
  8. 2062098Domain d3cefb1: 3cef B:249-384 [305163]
    Other proteins in same PDB: d3cefa_
    automated match to d4jkxb1
    complexed with gol, nag, so4, zea, zez

Details for d3cefb1

PDB Entry: 3cef (more details), 2.55 Å

PDB Description: X-ray Structure of Mistetletoe Lectin I in Complex with Zeatin
PDB Compounds: (B:) lectin I

SCOPe Domain Sequences for d3cefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cefb1 b.42.2.1 (B:249-384) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
dvtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn
gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv
qtldytlgqgwlagnd

SCOPe Domain Coordinates for d3cefb1:

Click to download the PDB-style file with coordinates for d3cefb1.
(The format of our PDB-style files is described here.)

Timeline for d3cefb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cefb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3cefa_