![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein automated matches [190608] (4 species) not a true protein |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries) |
![]() | Domain d3cefb1: 3cef B:249-384 [305163] Other proteins in same PDB: d3cefa_ automated match to d4jkxb1 complexed with gol, nag, so4, zea, zez |
PDB Entry: 3cef (more details), 2.55 Å
SCOPe Domain Sequences for d3cefb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cefb1 b.42.2.1 (B:249-384) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} dvtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv qtldytlgqgwlagnd
Timeline for d3cefb1: