SCOPe 2.08: Domain d3ceeb_: 3cee B:

Lineage for d3ceeb_ (3cee B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (6 PDB entries)

8. Domain d3ceeb_: 3cee B: [305161]
   automated match to d1mida_
   complexed with asy, na, tfa, zn

Details for d3ceeb_

PDB Entry: 3cee, 1.8 Å

PDB Description: Three-dimensional structure of a post translational modified barley LTP1

PDB Compounds: (B:) Non-specific lipid-transfer protein 1

SCOPe Domain Sequences for d3ceeb_:

Sequence; same for both SEQRES and ATOM records:

>d3ceeb_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy

Timeline for d3ceeb_:

• d3ceeb_ first appeared in SCOPe 2.06
  
• d3ceeb_ appears in SCOPe 2.07