| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
| Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
| Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species) |
| Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (6 PDB entries) |
| Domain d3ceeb_: 3cee B: [305161] automated match to d1mida_ complexed with asy, na, tfa, zn |
PDB Entry: 3cee (more details), 1.8 Å
SCOPe Domain Sequences for d3ceeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ceeb_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy
Timeline for d3ceeb_: