| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
| Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
| Protein automated matches [190549] (4 species) not a true protein |
| Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries) |
| Domain d3c93d_: 3c93 D: [305157] automated match to d3ng4a_ complexed with ndg, tla |
PDB Entry: 3c93 (more details), 2.6 Å
SCOPe Domain Sequences for d3c93d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c93d_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d3c93d_: