SCOPe 2.08: Domain d3c7be6: 3c7b E:197-261

Lineage for d3c7be6 (3c7b E:197-261)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein DsrB insert domain [160277] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries)
   Uniprot Q59110 197-261

8. Domain d3c7be6: 3c7b E:197-261 [305153]
   Other proteins in same PDB: d3c7bb4, d3c7bb5, d3c7be4, d3c7be5
   automated match to d3mmcb1
   complexed with sf4, so3, srm

Details for d3c7be6

PDB Entry: 3c7b, 2 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus

PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3c7be6:

Sequence; same for both SEQRES and ATOM records:

>d3c7be6 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

Timeline for d3c7be6:

• d3c7be6 first appeared in SCOPe 2.06
  
• d3c7be6 appears in SCOPe 2.07