Lineage for d3c4ib_ (3c4i B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715225Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries)
  8. 2715227Domain d3c4ib_: 3c4i B: [305147]
    automated match to d4pt4a_
    complexed with fmt

Details for d3c4ib_

PDB Entry: 3c4i (more details), 2.04 Å

PDB Description: Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]
PDB Compounds: (B:) DNA-binding protein HU homolog

SCOPe Domain Sequences for d3c4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c4ib_ a.55.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpa

SCOPe Domain Coordinates for d3c4ib_:

Click to download the PDB-style file with coordinates for d3c4ib_.
(The format of our PDB-style files is described here.)

Timeline for d3c4ib_: