Lineage for d1tyta1 (1tyt A:1-169,A:287-358)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67403Protein Trypanothione reductase [51947] (2 species)
  7. 67404Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 67429Domain d1tyta1: 1tyt A:1-169,A:287-358 [30513]
    Other proteins in same PDB: d1tyta3, d1tytb3

Details for d1tyta1

PDB Entry: 1tyt (more details), 2.6 Å

PDB Description: crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution

SCOP Domain Sequences for d1tyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyta1 c.3.1.5 (A:1-169,A:287-358) Trypanothione reductase {Crithidia fasciculata}
msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
tfhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlql
dkagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpra
td

SCOP Domain Coordinates for d1tyta1:

Click to download the PDB-style file with coordinates for d1tyta1.
(The format of our PDB-style files is described here.)

Timeline for d1tyta1: