Lineage for d1typb2 (1typ B:170-286)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67403Protein Trypanothione reductase [51947] (2 species)
  7. 67404Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 67428Domain d1typb2: 1typ B:170-286 [30512]
    Other proteins in same PDB: d1typa3, d1typb3

Details for d1typb2

PDB Entry: 1typ (more details), 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution

SCOP Domain Sequences for d1typb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1typb2 c.3.1.5 (B:170-286) Trypanothione reductase {Crithidia fasciculata}
egddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrg
fdselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaig

SCOP Domain Coordinates for d1typb2:

Click to download the PDB-style file with coordinates for d1typb2.
(The format of our PDB-style files is described here.)

Timeline for d1typb2: