SCOP 1.59: Domain d1typb1: 1typ B:2-169,B:287-358

Lineage for d1typb1 (1typ B:2-169,B:287-358)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)

6. Protein Trypanothione reductase [51947] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)

8. Domain d1typb1: 1typ B:2-169,B:287-358 [30511]
   Other proteins in same PDB: d1typa3, d1typb3

Details for d1typb1

PDB Entry: 1typ, 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution

SCOP Domain Sequences for d1typb1:

Sequence; same for both SEQRES and ATOM records:

>d1typb1 c.3.1.5 (B:2-169,B:287-358) Trypanothione reductase {Crithidia fasciculata}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgwgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqld
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

Timeline for d1typb1:

• d1typb1 first appeared (with stable ids) in SCOP 1.55
  
• d1typb1 appears in SCOP 1.57
  
• d1typb1 appears in SCOP 1.61
  
• d1typb1 appears in the current release, SCOPe 2.08