![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
![]() | Protein Trypanothione reductase [51947] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries) |
![]() | Domain d1typb1: 1typ B:2-169,B:287-358 [30511] Other proteins in same PDB: d1typa3, d1typb3 |
PDB Entry: 1typ (more details), 2.8 Å
SCOP Domain Sequences for d1typb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1typb1 c.3.1.5 (B:2-169,B:287-358) Trypanothione reductase {Crithidia fasciculata} sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt fhqgwgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqld kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat d
Timeline for d1typb1: