Lineage for d3bmfc_ (3bmf C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096189Species Trypanosoma brucei [TaxId:5702] [226801] (37 PDB entries)
  8. 2096292Domain d3bmfc_: 3bmf C: [305103]
    automated match to d4kwib_
    complexed with dtt, dx3, nap

Details for d3bmfc_

PDB Entry: 3bmf (more details), 1.95 Å

PDB Description: Structure of Pteridine Reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor DX3
PDB Compounds: (C:) pteridine reductase

SCOPe Domain Sequences for d3bmfc_:

Sequence, based on SEQRES records: (download)

>d3bmfc_ c.2.1.0 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3bmfc_ c.2.1.0 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
pflltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
gvapgvslgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglsl
vha

SCOPe Domain Coordinates for d3bmfc_:

Click to download the PDB-style file with coordinates for d3bmfc_.
(The format of our PDB-style files is described here.)

Timeline for d3bmfc_:

  • d3bmfc_ is new in SCOPe 2.06-stable