Lineage for d3bi8a_ (3bi8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085288Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2085306Species Clostridium botulinum [TaxId:441771] [189048] (2 PDB entries)
  8. 2085307Domain d3bi8a_: 3bi8 A: [305092]
    automated match to d3irda_
    complexed with gol, mlt, na

Details for d3bi8a_

PDB Entry: 3bi8 (more details), 1.96 Å

PDB Description: Structure of Dihydrodipicolinate synthase from Clostridium botulinum
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3bi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bi8a_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Clostridium botulinum [TaxId: 441771]}
sifkgsgvaiitpftntgvdfdklseliewhiksktdaiivcgttgeattmteterketi
kfvidkvnkripviagtgsnntaasiamskwaesigvdgllvitpyynkttqkglvkhfk
avsdavstpiiiynvpgrtglnitpgtlkelcedknivavkeasgnisqiaqikalcgdk
ldiysgnddqiipilalggigvisvlanvipedvhnmcelylngkvnealkiqldslalt
nalfietnpipvktamnlmnmkvgdlrlplcemnennleilkkelkaynlm

SCOPe Domain Coordinates for d3bi8a_:

Click to download the PDB-style file with coordinates for d3bi8a_.
(The format of our PDB-style files is described here.)

Timeline for d3bi8a_:

  • d3bi8a_ is new in SCOPe 2.06-stable