Lineage for d3bhga_ (3bhg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010459Species Legionella pneumophila [TaxId:272624] [311274] (1 PDB entry)
  8. 2010460Domain d3bhga_: 3bhg A: [305091]
    automated match to d2hvga_
    complexed with gol, so4

Details for d3bhga_

PDB Entry: 3bhg (more details), 1.9 Å

PDB Description: Crystal structure of adenylosuccinate lyase from Legionella pneumophila
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d3bhga_:

Sequence, based on SEQRES records: (download)

>d3bhga_ a.127.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
ltalnaispidgryvnktralspyfsefaltyyrlmveikwfeslaandtipevpaldnk
arkflsdlisnfneseaekikefekqtnhdvkaveyylqdkfqeneqlkscvafihfact
sedinnlayalmikqaiaqviqptiaeimgsitllgkqhadvamlsrthgqpatpttmgk
elvnfvarlkrpqqqlaevlipakfngavgnynahvaaypevdwrkhcanfvtslglsfn
ayttqiephdgiaevsqimvrinnilldytqdiwsyislgyfkqktiaeevgsstmphkv
npidfenaegnlglsnalfihfankltqsrmqrdlsdstvlrnlgvafsysliayhsvak
gndklqinksalqkdlsenwevlaeaiqtvmrrynepnayeqlkeltrgqmidaenlkkf
iktlsipeeakaelmkltpetytglatqlvkafs

Sequence, based on observed residues (ATOM records): (download)

>d3bhga_ a.127.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
ltalnaispidgryvnktralspyfsefaltyyrlmveikwfeslaandtipevpaldnk
arkflsdlisnfneseaekikefekqtnhdvkaveyylqdkfqeneqlkscvafihfact
sedinnlayalmikqaiaqviqptiaeimgsitllgkqhadvamlsrthgqpatpttmgk
elvnfvarlkrpqqqlaevlipakfngavgnynahvaaypevdwrkhcanfvtslglsfn
ayttqiephdgiaevsqimvrinnilldytqdiwsyislgyfkqktsstmphkvnpidfe
naegnlglsnalfihfankltqsrmqrdlsdstvlrnlgvafsysliayhsvakgndklq
inksalqkdlsenwevlaeaiqtvmrrynepnayeqlkeltrgqmidaenlkkfiktlsi
peeakaelmkltpetytglatqlvkafs

SCOPe Domain Coordinates for d3bhga_:

Click to download the PDB-style file with coordinates for d3bhga_.
(The format of our PDB-style files is described here.)

Timeline for d3bhga_:

  • d3bhga_ is new in SCOPe 2.06-stable