Lineage for d2tprb2 (2tpr B:169-285)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21089Protein Trypanothione reductase [51947] (2 species)
  7. 21090Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 21110Domain d2tprb2: 2tpr B:169-285 [30508]
    Other proteins in same PDB: d2tpra3, d2tprb3

Details for d2tprb2

PDB Entry: 2tpr (more details), 2.4 Å

PDB Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution

SCOP Domain Sequences for d2tprb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tprb2 c.3.1.5 (B:169-285) Trypanothione reductase {Crithidia fasciculata}
egddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrg
fdselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaig

SCOP Domain Coordinates for d2tprb2:

Click to download the PDB-style file with coordinates for d2tprb2.
(The format of our PDB-style files is described here.)

Timeline for d2tprb2: