Lineage for d3b9pa_ (3b9p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114132Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (9 PDB entries)
  8. 2114138Domain d3b9pa_: 3b9p A: [305078]
    automated match to d4lcba_
    complexed with cl

Details for d3b9pa_

PDB Entry: 3b9p (more details), 2.7 Å

PDB Description: Spastin
PDB Compounds: (A:) CG5977-PA, isoform A

SCOPe Domain Sequences for d3b9pa_:

Sequence, based on SEQRES records: (download)

>d3b9pa_ c.37.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klvqlildeiveggakvewtdiagqdvakqalqemvilpsvrpelftglrapakglllfg
ppgngktllaravatecsatflnisaasltskyvgdgeklvralfavarhmqpsiifide
vdsllserssseheasrrlkteflvefdglpgnpdgdrivvlaatnrpqeldeaalrrft
krvyvslpdeqtrelllnrllqkqgspldtealrrlakitdgysgsdltalakdaalepi
relnveqvkcldisamraiteqdfhsslkrirrsvapqslnsyekws

Sequence, based on observed residues (ATOM records): (download)

>d3b9pa_ c.37.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klvqlildeiveggakvewtdiagqdvakqalqemvilpsvrpelftglrapakglllfg
ppgngktllaravatecsatflnisaasltskyvgdgeklvralfavarhmqpsiifide
vdsllsereasrrlkteflvefdglprivvlaatnrpqeldeaalrrftkrvyvslpdeq
trelllnrllqkqgspldtealrrlakitdgysgsdltalakdaalepirelnisamrai
teqdfhsslkrirrsvapqslnsyekws

SCOPe Domain Coordinates for d3b9pa_:

Click to download the PDB-style file with coordinates for d3b9pa_.
(The format of our PDB-style files is described here.)

Timeline for d3b9pa_:

  • d3b9pa_ is new in SCOPe 2.06-stable