Lineage for d3b8ed_ (3b8e D:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579472Superfamily f.23.42: Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310574] (2 families) (S)
  5. 2579473Family f.23.42.1: Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310612] (1 protein)
  6. 2579474Protein Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310695] (2 species)
  7. 2579490Species Pig (Sus scrofa) [TaxId:9823] [310916] (1 PDB entry)
  8. 2579492Domain d3b8ed_: 3b8e D: [305075]
    Other proteins in same PDB: d3b8ea1, d3b8ea2, d3b8ea3, d3b8ea4, d3b8ec1, d3b8ec2, d3b8ec3, d3b8ec4, d3b8eg_, d3b8eh_
    complexed with mf4, mg, pc1, rb

Details for d3b8ed_

PDB Entry: 3b8e (more details), 3.5 Å

PDB Description: Crystal structure of the sodium-potassium pump
PDB Compounds: (D:) Sodium/potassium-transporting ATPase subunit beta-1

SCOPe Domain Sequences for d3b8ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8ed_ f.23.42.1 (D:) Sodium/potassium-transporting ATPase, beta subunit transmembrane helix {Pig (Sus scrofa) [TaxId: 9823]}
tggswfkillfyvifygclagifigtiqvmlltisefkptyqdrva

SCOPe Domain Coordinates for d3b8ed_:

Click to download the PDB-style file with coordinates for d3b8ed_.
(The format of our PDB-style files is described here.)

Timeline for d3b8ed_: