Lineage for d3b8ec2 (3b8e C:362-378,C:587-758)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919808Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2919868Protein Sodium/potassium-transporting ATPase alpha chain [310692] (2 species)
  7. 2919885Species Pig (Sus scrofa) [TaxId:9823] [310910] (1 PDB entry)
  8. 2919887Domain d3b8ec2: 3b8e C:362-378,C:587-758 [305072]
    Other proteins in same PDB: d3b8ea1, d3b8ea3, d3b8ea4, d3b8eb_, d3b8ec1, d3b8ec3, d3b8ec4, d3b8ed_, d3b8eg_, d3b8eh_
    complexed with mf4, mg, pc1, rb

Details for d3b8ec2

PDB Entry: 3b8e (more details), 3.5 Å

PDB Description: Crystal structure of the sodium-potassium pump
PDB Compounds: (C:) Sodium/potassium-transporting ATPase subunit alpha-1

SCOPe Domain Sequences for d3b8ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8ec2 c.108.1.7 (C:362-378,C:587-758) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]}
ststicsdktgtltqnrXppraavpdavgkcrsagikvimvtgdhpitakaiakgvgiis
egnetvediaarlnipvsqvnprdakacvvhgsdlkdmtseqlddilkyhteivfartsp
qqkliivegcqrqgaivavtgdgvndspaskkadigvamgiagsdvskqaadmillddnf
asivtgveeg

SCOPe Domain Coordinates for d3b8ec2:

Click to download the PDB-style file with coordinates for d3b8ec2.
(The format of our PDB-style files is described here.)

Timeline for d3b8ec2: