Lineage for d3b8ea4 (3b8e A:19-159,A:268-361,A:759-1016)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255902Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 2255903Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 2255904Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 2255960Protein Sodium/potassium-transporting ATPase, transmembrane domain [310694] (2 species)
    the N-terminal 57 residues interact with/form a part of the acuator domain A
  7. 2255977Species Pig (Sus scrofa) [TaxId:9823] [310914] (1 PDB entry)
  8. 2255978Domain d3b8ea4: 3b8e A:19-159,A:268-361,A:759-1016 [305069]
    Other proteins in same PDB: d3b8ea1, d3b8ea2, d3b8ea3, d3b8eb_, d3b8ec1, d3b8ec2, d3b8ec3, d3b8ed_, d3b8eg_, d3b8eh_
    complexed with mf4, mg, pc1, rb

Details for d3b8ea4

PDB Entry: 3b8e (more details), 3.5 Å

PDB Description: Crystal structure of the sodium-potassium pump
PDB Compounds: (A:) Sodium/potassium-transporting ATPase subunit alpha-1

SCOPe Domain Sequences for d3b8ea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8ea4 f.33.1.1 (A:19-159,A:268-361,A:759-1016) Sodium/potassium-transporting ATPase, transmembrane domain {Pig (Sus scrofa) [TaxId: 9823]}
akkerdmdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppt
tpewvkfcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgc
fsyyqeaksskimesfknmvpXsgleggqtpiaaeiehfihiitgvavflgvsffilsli
leytwleavifligiivanvpegllatvtvcltltakrmarknclvknleavetlgXrli
fdnlkksiaytltsnipeitpflifiianiplplgtvtilcidlgtdmvpaislayeqae
sdimkrqprnpktdklvneqlismaygqigmiqalggfftyfvilaengflpihllglrv
nwddrwindvedsygqqwtyeqrkiveftchtpffvtivvvqwadlvicktrrnsvfqqg
mknkilifglfeetalaaflsycpgmgvalrmyplkptwwfcafpysllifvydevrkli
irrrpggwveketyy

SCOPe Domain Coordinates for d3b8ea4:

Click to download the PDB-style file with coordinates for d3b8ea4.
(The format of our PDB-style files is described here.)

Timeline for d3b8ea4: