Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) |
Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins) |
Protein Sodium/potassium-transporting ATPase, transmembrane domain [310694] (2 species) the N-terminal 57 residues interact with/form a part of the acuator domain A |
Species Pig (Sus scrofa) [TaxId:9823] [310914] (1 PDB entry) |
Domain d3b8ea4: 3b8e A:19-159,A:268-361,A:759-1016 [305069] Other proteins in same PDB: d3b8ea1, d3b8ea2, d3b8ea3, d3b8eb_, d3b8ec1, d3b8ec2, d3b8ec3, d3b8ed_, d3b8eg_, d3b8eh_ complexed with mf4, mg, pc1, rb |
PDB Entry: 3b8e (more details), 3.5 Å
SCOPe Domain Sequences for d3b8ea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8ea4 f.33.1.1 (A:19-159,A:268-361,A:759-1016) Sodium/potassium-transporting ATPase, transmembrane domain {Pig (Sus scrofa) [TaxId: 9823]} akkerdmdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppt tpewvkfcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgc fsyyqeaksskimesfknmvpXsgleggqtpiaaeiehfihiitgvavflgvsffilsli leytwleavifligiivanvpegllatvtvcltltakrmarknclvknleavetlgXrli fdnlkksiaytltsnipeitpflifiianiplplgtvtilcidlgtdmvpaislayeqae sdimkrqprnpktdklvneqlismaygqigmiqalggfftyfvilaengflpihllglrv nwddrwindvedsygqqwtyeqrkiveftchtpffvtivvvqwadlvicktrrnsvfqqg mknkilifglfeetalaaflsycpgmgvalrmyplkptwwfcafpysllifvydevrkli irrrpggwveketyy
Timeline for d3b8ea4: