SCOPe 2.08: Domain d3b3ea_: 3b3e A:

Lineage for d3b3ea_ (3b3e A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (31 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196103] (4 PDB entries)

8. Domain d3b3ea_: 3b3e A: [305054]
   automated match to d3f7ja_
   complexed with no3

Details for d3b3ea_

PDB Entry: 3b3e, 1.8 Å

PDB Description: B.subtilis YvgN

PDB Compounds: (A:) YvgN protein

SCOPe Domain Sequences for d3b3ea_:

Sequence; same for both SEQRES and ATOM records:

>d3b3ea_ c.1.7.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mptslkdtvklhngvempwfglgvfkvengneatesvkaaikngyrsidtaaiykneegv
gigikesgvareelfitskvwnedqgyettlaafekslerlqldyldlylihwpgkdkyk
dtwraleklykdgkiraigvsnfqvhhleellkdaeikpmvnqvefhprltqkelrdyck
gqgiqleawsplmqgqlldnevltqiaekhnksvaqvilrwdlqhgvvtipksikehrii
enadifdfelsqedmdkidalnkdervgpnpdellf

Timeline for d3b3ea_:

• d3b3ea_ first appeared in SCOPe 2.06
  
• d3b3ea_ appears in SCOPe 2.07