SCOPe 2.06: Domain d3b2qb2: 3b2q B:76-350

Lineage for d3b2qb2 (3b2q B:76-350)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311242] (3 PDB entries)

8. Domain d3b2qb2: 3b2q B:76-350 [305052]
   Other proteins in same PDB: d3b2qa1, d3b2qa3, d3b2qb1, d3b2qb3
   automated match to d3j9tb2
   complexed with aes, atp, cit; mutant

Details for d3b2qb2

PDB Entry: 3b2q, 2.1 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3b2qb2:

Sequence, based on SEQRES records:

>d3b2qb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Sequence, based on observed residues (ATOM records):

>d3b2qb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsgyiteg
qivvarelhrkgiyppinvlpslsrl

Timeline for d3b2qb2:

• d3b2qb2 is new in SCOPe 2.06-stable
  
• d3b2qb2 appears in SCOPe 2.07
  
• d3b2qb2 appears in the current release, SCOPe 2.08