Lineage for d3b2qb2 (3b2q B:76-350)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128900Species Methanosarcina mazei [TaxId:2209] [311242] (3 PDB entries)
  8. 2128902Domain d3b2qb2: 3b2q B:76-350 [305052]
    Other proteins in same PDB: d3b2qa1, d3b2qa3, d3b2qb1, d3b2qb3
    automated match to d3j9tb2
    complexed with aes, atp, cit; mutant

Details for d3b2qb2

PDB Entry: 3b2q (more details), 2.1 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase
PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3b2qb2:

Sequence, based on SEQRES records: (download)

>d3b2qb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Sequence, based on observed residues (ATOM records): (download)

>d3b2qb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsgyiteg
qivvarelhrkgiyppinvlpslsrl

SCOPe Domain Coordinates for d3b2qb2:

Click to download the PDB-style file with coordinates for d3b2qb2.
(The format of our PDB-style files is described here.)

Timeline for d3b2qb2: