Lineage for d3b2ba_ (3b2b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141985Protein automated matches [190709] (4 species)
    not a true protein
  7. 2141986Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189866] (2 PDB entries)
  8. 2141987Domain d3b2ba_: 3b2b A: [305047]
    automated match to d3uwda_
    complexed with btb, cl, mg, unl

Details for d3b2ba_

PDB Entry: 3b2b (more details), 1.68 Å

PDB Description: Crystal Structure of Phosphoglycerate Kinase from Bacillus Anthracis
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d3b2ba_:

Sequence, based on SEQRES records: (download)

>d3b2ba_ c.86.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mnkksirdvdlkgkrvfcrvdfnvpmkegkitdetriraalptiqylveqgakvilashl
grpkgqaveelrltpvaarlgellgkdvkkadeafgpvaqemvaamnegdvlvlenvrfy
ageekndaelakefaaladifvndafgaahrahastagiadylpavsgllmekelevlgk
alsnperpfaaiiggakvkdkiglirhlldkvdnliiggglaytfvkalgheiglslced
dkielakefmqlakekgvnfympvdvviteefsetattkivgidsipsnwegvdigpktr
eiyadviknsklvvwngpmgvfemtpfaegtkavgqaladaegtysvigggdsaaavekf
gmadkmshistgggaslefmegkelpgvvclndk

Sequence, based on observed residues (ATOM records): (download)

>d3b2ba_ c.86.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mnkksirdvdlkgkrvfcrvdfnvpmgkitdetriraalptiqylveqgakvilashlgr
pkgqaveelrltpvaarlgellgkdvkkadeafgpvaqemvaamnegdvlvlenvrfyag
eekndaelakefaaladifvndafgaahrahastagiadylpavsgllmekelevlgkal
snperpfaaiiggakvkdkiglirhlldkvdnliiggglaytfvkalgheiglslceddk
ielakefmqlakekgvnfympvdvviteefsetattkivgidsipsnwegvdigpktrei
yadviknsklvvwngpmgvfemtpfaegtkavgqaladaegtysvigggdsaaavekfgm
adkmshistgggaslefmegkelpgvvclndk

SCOPe Domain Coordinates for d3b2ba_:

Click to download the PDB-style file with coordinates for d3b2ba_.
(The format of our PDB-style files is described here.)

Timeline for d3b2ba_:

  • d3b2ba_ is new in SCOPe 2.06-stable