Lineage for d1fead2 (1fea D:170-286)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176396Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
  6. 176572Protein Trypanothione reductase [51947] (2 species)
  7. 176573Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 176589Domain d1fead2: 1fea D:170-286 [30504]
    Other proteins in same PDB: d1feaa3, d1feab3, d1feac3, d1fead3

Details for d1fead2

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution

SCOP Domain Sequences for d1fead2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fead2 c.3.1.5 (D:170-286) Trypanothione reductase {Crithidia fasciculata}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

SCOP Domain Coordinates for d1fead2:

Click to download the PDB-style file with coordinates for d1fead2.
(The format of our PDB-style files is described here.)

Timeline for d1fead2: