Lineage for d3azza_ (3azz A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050469Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2050500Protein Beta-1,3-glucanase [310824] (3 species)
    Pfam PF03935
  7. 2050506Species Thermotoga maritima MSB8 [TaxId:243274] [311093] (5 PDB entries)
  8. 2050519Domain d3azza_: 3azz A: [305035]
    complexed with ca, lgc, so4

Details for d3azza_

PDB Entry: 3azz (more details), 1.81 Å

PDB Description: crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with gluconolactone
PDB Compounds: (A:) Laminarinase

SCOPe Domain Sequences for d3azza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azza_ b.29.1.2 (A:) Beta-1,3-glucanase {Thermotoga maritima MSB8 [TaxId: 243274]}
edwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviea
rkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgw
ptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewde
devewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmy
idyirvykdm

SCOPe Domain Coordinates for d3azza_:

Click to download the PDB-style file with coordinates for d3azza_.
(The format of our PDB-style files is described here.)

Timeline for d3azza_: