Lineage for d3azyb_ (3azy B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779112Protein Beta-1,3-glucanase [310824] (3 species)
    Pfam PF03935
  7. 2779118Species Thermotoga maritima MSB8 [TaxId:243274] [311093] (5 PDB entries)
  8. 2779120Domain d3azyb_: 3azy B: [305032]
    automated match to d3azza_
    complexed with ca, so4

Details for d3azyb_

PDB Entry: 3azy (more details), 1.65 Å

PDB Description: Crystal structure of the laminarinase catalytic domain from Thermotoga maritima MSB8
PDB Compounds: (B:) Laminarinase

SCOPe Domain Sequences for d3azyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azyb_ b.29.1.2 (B:) Beta-1,3-glucanase {Thermotoga maritima MSB8 [TaxId: 243274]}
edwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviea
rkeqvsdeygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgw
ptcgeidimemlghdtrtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewde
devewyvdgqlyhvlskdelaelglewvfdhpfflilnvavggywpgypdettqfpqrmy
idyirvykdmn

SCOPe Domain Coordinates for d3azyb_:

Click to download the PDB-style file with coordinates for d3azyb_.
(The format of our PDB-style files is described here.)

Timeline for d3azyb_: