Lineage for d3awoa2 (3awo A:19-262)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080829Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2080830Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 protein domains)
  6. 2080857Protein D-serine dehydratase [310801] (2 species)
  7. 2080858Species Chicken (Gallus gallus) [TaxId:9031] [311066] (4 PDB entries)
  8. 2080861Domain d3awoa2: 3awo A:19-262 [305027]
    Other proteins in same PDB: d3awoa1
    automated match to d3anua2
    complexed with dsn, plp

Details for d3awoa2

PDB Entry: 3awo (more details), 2.65 Å

PDB Description: crystal structure of d-serine dehydratase in complex with d-serine from chicken kidney (edta-treated)
PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3awoa2:

Sequence, based on SEQRES records: (download)

>d3awoa2 c.1.6.1 (A:19-262) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
rttarrnaermrercralgvrlrphvkthktleggllatggtrrgiavstlaearffadg
gfddillaypvptarleecaglarrldafhvlldrpealaslrqrplghgkrwlvwlkld
cgngragvrptdpaalelaqaiandapeevtlvgvyahcgntygcsgadtiqaiartttn
avlsfvaalrqagvpcpqasigstpscshpipemsqltelhpgnyifydlqqtqlgscqp
qdva

Sequence, based on observed residues (ATOM records): (download)

>d3awoa2 c.1.6.1 (A:19-262) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
rttarrnaermrercralgvrlrphvkthktleggllatggtrrgiavstlaearffadg
gfddillaypvptarleecaglarrldafhvlldrpealaslrqrplghgkrwlvwlkld
cgragvrptdpaalelaqaiandapeevtlvgvyahcgntygcsgadtiqaiartttnav
lsfvaalrqagvpcpqasigstpscshpipemsqltelhpgnyifydlqqtqlgscqpqd
va

SCOPe Domain Coordinates for d3awoa2:

Click to download the PDB-style file with coordinates for d3awoa2.
(The format of our PDB-style files is described here.)

Timeline for d3awoa2:

  • d3awoa2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3awoa1