SCOPe 2.06: Domain d3awoa1: 3awo A:1-18,A:263-376

Lineage for d3awoa1 (3awo A:1-18,A:263-376)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)

6. Protein D-serine dehydratase [310800] (2 species)
   Pfam PF14031

7. Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries)

8. Domain d3awoa1: 3awo A:1-18,A:263-376 [305026]
   Other proteins in same PDB: d3awoa2
   automated match to d3anua1
   complexed with dsn, plp

Details for d3awoa1

PDB Entry: 3awo, 2.65 Å

PDB Description: crystal structure of d-serine dehydratase in complex with d-serine from chicken kidney (edta-treated)

PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3awoa1:

Sequence, based on SEQRES records:

>d3awoa1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgca
aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee
gkvvalwhpvrgw

Sequence, based on observed residues (ATOM records):

>d3awoa1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgaggpqgcaaid
ghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvval
whpvrgw

Timeline for d3awoa1:

• d3awoa1 is new in SCOPe 2.06-stable
  
• d3awoa1 appears in SCOPe 2.07
  
• d3awoa1 appears in the current release, SCOPe 2.08