Lineage for d3awna1 (3awn A:1-18,A:263-376)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408514Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2408515Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)
  6. 2408542Protein D-serine dehydratase [310800] (2 species)
    Pfam PF14031
  7. 2408543Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries)
  8. 2408547Domain d3awna1: 3awn A:1-18,A:263-376 [305024]
    Other proteins in same PDB: d3awna2
    automated match to d3anua1
    complexed with plp

Details for d3awna1

PDB Entry: 3awn (more details), 2.8 Å

PDB Description: crystal structure of d-serine dehydratase from chicken kidney (edta treated)
PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3awna1:

Sequence, based on SEQRES records: (download)

>d3awna1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgca
aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee
gkvvalwhpvrgw

Sequence, based on observed residues (ATOM records): (download)

>d3awna1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgaggpqgcaaid
ghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvval
whpvrgw

SCOPe Domain Coordinates for d3awna1:

Click to download the PDB-style file with coordinates for d3awna1.
(The format of our PDB-style files is described here.)

Timeline for d3awna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3awna2