SCOPe 2.06: Domain d3atga_: 3atg A:

Lineage for d3atga_ (3atg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
   Pfam PF00722
   beta-Glucanase-like

6. Protein automated matches [191047] (8 species)
   not a true protein

7. Species Cellulosimicrobium cellulans [TaxId:1710] [311271] (1 PDB entry)

8. Domain d3atga_: 3atg A: [305021]
   automated match to d2hyka_
   complexed with ca, gol, po4

Details for d3atga_

PDB Entry: 3atg, 1.66 Å

PDB Description: endo-1,3-beta-glucanase from cellulosimicrobium cellulans

PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d3atga_:

Sequence; same for both SEQRES and ATOM records:

>d3atga_ b.29.1.2 (A:) automated matches {Cellulosimicrobium cellulans [TaxId: 1710]}
apgdllwsdefdgaagsapnpavwnhetgahgwgnaelqnytasransaldgqgnlvita
rregdgsytsarmttqgkyqpqygrieariqiprgqgiwpafwmlggsfpgtpwpssgei
dimenvgfephrvhgtvhgpgysggsgitgmyqhpqgwsfadtfhtfavdwkpgeitwfv
dgqqfhrvtrasvganawvfdqpfflilnvavggqwpgypdgttqlpqqmkvdyvrvydn
gs

Timeline for d3atga_:

• d3atga_ is new in SCOPe 2.06-stable
  
• d3atga_ appears in SCOPe 2.07
  
• d3atga_ appears in the current release, SCOPe 2.08