Lineage for d3atga_ (3atg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779165Protein automated matches [191047] (8 species)
    not a true protein
  7. 2779171Species Cellulosimicrobium cellulans [TaxId:1710] [311271] (1 PDB entry)
  8. 2779172Domain d3atga_: 3atg A: [305021]
    automated match to d2hyka_
    complexed with ca, gol, po4

Details for d3atga_

PDB Entry: 3atg (more details), 1.66 Å

PDB Description: endo-1,3-beta-glucanase from cellulosimicrobium cellulans
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d3atga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atga_ b.29.1.2 (A:) automated matches {Cellulosimicrobium cellulans [TaxId: 1710]}
apgdllwsdefdgaagsapnpavwnhetgahgwgnaelqnytasransaldgqgnlvita
rregdgsytsarmttqgkyqpqygrieariqiprgqgiwpafwmlggsfpgtpwpssgei
dimenvgfephrvhgtvhgpgysggsgitgmyqhpqgwsfadtfhtfavdwkpgeitwfv
dgqqfhrvtrasvganawvfdqpfflilnvavggqwpgypdgttqlpqqmkvdyvrvydn
gs

SCOPe Domain Coordinates for d3atga_:

Click to download the PDB-style file with coordinates for d3atga_.
(The format of our PDB-style files is described here.)

Timeline for d3atga_: