Lineage for d3asba_ (3asb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132394Species Chlamydia trachomatis [TaxId:813] [311270] (2 PDB entries)
  8. 2132396Domain d3asba_: 3asb A: [305020]
    automated match to d3qgua_
    complexed with llp

Details for d3asba_

PDB Entry: 3asb (more details), 2.7 Å

PDB Description: Crystal structure of PLP-bound LL-diaminopimelate aminotransferase from Chlamydia trachomatis
PDB Compounds: (A:) LL-diaminopimelate aminotransferase

SCOPe Domain Sequences for d3asba_:

Sequence, based on SEQRES records: (download)

>d3asba_ c.67.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
mkrnphfvsltknylfadlqkrvaqfrlenpqhtvinlsigdttqplnasvaeafassia
rlsspttcrgygpdfglpalrqklsedfyrgfvdakeifisdgakvdlfrllsffgpnqt
vaiqdpsypayldiarltgakeiialpclqenaffpefpedthidilclcspnnptgtvl
nkdqlraivhyaieheililfdaaystfisdpslpksifeipdarfcaieinsfskplgf
agirlgwtvipqeltyadghfviqdwerflsttfngasipaqeagvaglsilpqleaihy
yrensdllrkallatgfevfggehapylwvkptqanisdrdlfdfflreyhiaitpgigf
grsgsgfvrfsslgkredilaacerlqm

Sequence, based on observed residues (ATOM records): (download)

>d3asba_ c.67.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
mkrnphfvslfadlqkrvaqfrlenpqvinlsigplnasvaeafassiarlssptdfglp
alrqklsedfyrgfvdakeifisdgakvdlfrllsffgpnqtvaiqdpsypayldiarlt
gakeiialpclqenaffpefpedthidilclcspnnptgtvlnkdqlraivhyaieheil
ilfdaaystfisdpslpksifeipdarfcaieinsfsplgfagirlgwtvipqeltyadg
hfviqdwerflsttfngasipaqeagvaglsilpqleaihyyrensdllrkallatgfev
fggehapylwvkpdrdlfdfflreyhiaitpgigfgrsgsgfvrfsslgkredilaacer
lqm

SCOPe Domain Coordinates for d3asba_:

Click to download the PDB-style file with coordinates for d3asba_.
(The format of our PDB-style files is described here.)

Timeline for d3asba_:

  • d3asba_ is new in SCOPe 2.06-stable