Lineage for d3arcv_ (3arc V:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690853Protein Cytochrome c550 [100991] (3 species)
  7. 2690859Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)
  8. 2690861Domain d3arcv_: 3arc V: [305016]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcx_, d3arcz_
    automated match to d3a0hv_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcv_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d3arcv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d3arcv_:

Click to download the PDB-style file with coordinates for d3arcv_.
(The format of our PDB-style files is described here.)

Timeline for d3arcv_: