![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries) |
![]() | Domain d3aogl1: 3aog L:4-187 [304998] Other proteins in same PDB: d3aoga2, d3aogb2, d3aogc2, d3aogd2, d3aoge2, d3aogf2, d3aogg2, d3aogh2, d3aogi2, d3aogj2, d3aogk2, d3aogl2 automated match to d4xgia1 complexed with glu, nh4, po4 |
PDB Entry: 3aog (more details), 2.1 Å
SCOPe Domain Sequences for d3aogl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aogl1 c.58.1.0 (L:4-187) automated matches {Thermus thermophilus [TaxId: 262724]} eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg kpia
Timeline for d3aogl1: