SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3aogk2 (3aog K:188-424)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2096152Species Thermus thermophilus [TaxId:262724] [270920] (3 PDB entries)
  8. 2096163Domain d3aogk2: 3aog K:188-424 [304997]
    Other proteins in same PDB: d3aoga1, d3aogb1, d3aogc1, d3aogd1, d3aoge1, d3aogf1, d3aogg1, d3aogh1, d3aogi1, d3aogj1, d3aogk1, d3aogl1
    automated match to d4xgia2
    complexed with glu, nh4, po4

Details for d3aogk2

PDB Entry: 3aog (more details), 2.1 Å

PDB Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)
PDB Compounds: (K:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aogk2:

Sequence, based on SEQRES records: (download)

>d3aogk2 c.2.1.0 (K:188-424) automated matches {Thermus thermophilus [TaxId: 262724]}
lggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhgarvva
vqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaalekqi
teqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfns
yfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp

Sequence, based on observed residues (ATOM records): (download)

>d3aogk2 c.2.1.0 (K:188-424) automated matches {Thermus thermophilus [TaxId: 262724]}
lggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhgarvva
vqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaalekqi
teqnarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfnsyfwte
eeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp

SCOPe Domain Coordinates for d3aogk2:

Click to download the PDB-style file with coordinates for d3aogk2.
(The format of our PDB-style files is described here.)

Timeline for d3aogk2:

  • d3aogk2 is new in SCOPe 2.06-stable