Lineage for d3aogi2 (3aog I:188-424)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457247Species Thermus thermophilus [TaxId:262724] [270920] (3 PDB entries)
  8. 2457256Domain d3aogi2: 3aog I:188-424 [304993]
    Other proteins in same PDB: d3aoga1, d3aogb1, d3aogc1, d3aogd1, d3aoge1, d3aogf1, d3aogg1, d3aogh1, d3aogi1, d3aogj1, d3aogk1, d3aogl1
    automated match to d4xgia2
    complexed with glu, nh4, po4

Details for d3aogi2

PDB Entry: 3aog (more details), 2.1 Å

PDB Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)
PDB Compounds: (I:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aogi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aogi2 c.2.1.0 (I:188-424) automated matches {Thermus thermophilus [TaxId: 262724]}
lggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhgarvva
vqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaalekqi
teqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfns
yfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp

SCOPe Domain Coordinates for d3aogi2:

Click to download the PDB-style file with coordinates for d3aogi2.
(The format of our PDB-style files is described here.)

Timeline for d3aogi2: