SCOPe 2.06: Domain d3aogi2: 3aog I:188-424

Lineage for d3aogi2 (3aog I:188-424)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [270920] (3 PDB entries)

8. Domain d3aogi2: 3aog I:188-424 [304993]
   Other proteins in same PDB: d3aoga1, d3aogb1, d3aogc1, d3aogd1, d3aoge1, d3aogf1, d3aogg1, d3aogh1, d3aogi1, d3aogj1, d3aogk1, d3aogl1
   automated match to d4xgia2
   complexed with glu, nh4, po4

Details for d3aogi2

PDB Entry: 3aog, 2.1 Å

PDB Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)

PDB Compounds: (I:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aogi2:

Sequence; same for both SEQRES and ATOM records:

>d3aogi2 c.2.1.0 (I:188-424) automated matches {Thermus thermophilus [TaxId: 262724]}
lggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhgarvva
vqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaalekqi
teqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfns
yfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp

Timeline for d3aogi2:

• d3aogi2 is new in SCOPe 2.06-stable
  
• d3aogi2 appears in SCOPe 2.07
  
• d3aogi2 appears in the current release, SCOPe 2.08