Lineage for d1feab1 (1fea B:1-169,B:287-357)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21089Protein Trypanothione reductase [51947] (2 species)
  7. 21090Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 21101Domain d1feab1: 1fea B:1-169,B:287-357 [30499]
    Other proteins in same PDB: d1feaa3, d1feab3, d1feac3, d1fead3

Details for d1feab1

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution

SCOP Domain Sequences for d1feab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feab1 c.3.1.5 (B:1-169,B:287-357) Trypanothione reductase {Crithidia fasciculata}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgieXvprsqtlqle
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

SCOP Domain Coordinates for d1feab1:

Click to download the PDB-style file with coordinates for d1feab1.
(The format of our PDB-style files is described here.)

Timeline for d1feab1: