Lineage for d3aogf1 (3aog F:4-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890865Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries)
  8. 2890871Domain d3aogf1: 3aog F:4-187 [304986]
    Other proteins in same PDB: d3aoga2, d3aogb2, d3aogc2, d3aogd2, d3aoge2, d3aogf2, d3aogg2, d3aogh2, d3aogi2, d3aogj2, d3aogk2, d3aogl2
    automated match to d4xgia1
    complexed with glu, nh4, po4

Details for d3aogf1

PDB Entry: 3aog (more details), 2.1 Å

PDB Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aogf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aogf1 c.58.1.0 (F:4-187) automated matches {Thermus thermophilus [TaxId: 262724]}
eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
kpia

SCOPe Domain Coordinates for d3aogf1:

Click to download the PDB-style file with coordinates for d3aogf1.
(The format of our PDB-style files is described here.)

Timeline for d3aogf1: