SCOPe 2.06: Domain d3aogd1: 3aog D:4-187

Lineage for d3aogd1 (3aog D:4-187)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries)

8. Domain d3aogd1: 3aog D:4-187 [304982]
   Other proteins in same PDB: d3aoga2, d3aogb2, d3aogc2, d3aogd2, d3aoge2, d3aogf2, d3aogg2, d3aogh2, d3aogi2, d3aogj2, d3aogk2, d3aogl2
   automated match to d4xgia1
   complexed with glu, nh4, po4

Details for d3aogd1

PDB Entry: 3aog, 2.1 Å

PDB Description: Crystal structure of glutamate dehydrogenase (GdhB) from Thermus thermophilus (Glu bound form)

PDB Compounds: (D:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aogd1:

Sequence; same for both SEQRES and ATOM records:

>d3aogd1 c.58.1.0 (D:4-187) automated matches {Thermus thermophilus [TaxId: 262724]}
eplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvayf
egyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdprk
lspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvtg
kpia

Timeline for d3aogd1:

• d3aogd1 is new in SCOPe 2.06-stable
  
• d3aogd1 appears in SCOPe 2.07
  
• d3aogd1 appears in the current release, SCOPe 2.08