Lineage for d1feaa2 (1fea A:170-286)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833443Protein Trypanothione reductase [51947] (3 species)
  7. 1833444Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 1833454Domain d1feaa2: 1fea A:170-286 [30498]
    Other proteins in same PDB: d1feaa3, d1feab3, d1feac3, d1fead3
    complexed with fad

Details for d1feaa2

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution
PDB Compounds: (A:) trypanothione reductase

SCOPe Domain Sequences for d1feaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feaa2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

SCOPe Domain Coordinates for d1feaa2:

Click to download the PDB-style file with coordinates for d1feaa2.
(The format of our PDB-style files is described here.)

Timeline for d1feaa2: