Lineage for d3aoeb1 (3aoe B:1-187)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2466799Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2466800Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2467113Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2467114Protein automated matches [226864] (30 species)
    not a true protein
  7. 2467284Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries)
  8. 2467298Domain d3aoeb1: 3aoe B:1-187 [304974]
    Other proteins in same PDB: d3aoea2, d3aoeb2
    automated match to d4xgia1
    complexed with leu

Details for d3aoeb1

PDB Entry: 3aoe (more details), 2.6 Å

PDB Description: Crystal structure of hetero-hexameric glutamate dehydrogenase from Thermus thermophilus (Leu bound form)
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aoeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aoeb1 c.58.1.0 (B:1-187) automated matches {Thermus thermophilus [TaxId: 262724]}
mkseplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsv
ayfegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvd
prklspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgv
vtgkpia

SCOPe Domain Coordinates for d3aoeb1:

Click to download the PDB-style file with coordinates for d3aoeb1.
(The format of our PDB-style files is described here.)

Timeline for d3aoeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aoeb2